ABHD5 monoclonal antibody (M02), clone 4B12
  • ABHD5 monoclonal antibody (M02), clone 4B12

ABHD5 monoclonal antibody (M02), clone 4B12

Ref: AB-H00051099-M02
ABHD5 monoclonal antibody (M02), clone 4B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ABHD5.
Información adicional
Size 100 ug
Gene Name ABHD5
Gene Alias CDS|CGI58|IECN2|MGC8731|NCIE2
Gene Description abhydrolase domain containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABHD5 (NP_057090, 240 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51099
Clone Number 4B12
Iso type IgG1 Kappa

Enviar uma mensagem


ABHD5 monoclonal antibody (M02), clone 4B12

ABHD5 monoclonal antibody (M02), clone 4B12