GAL monoclonal antibody (M01), clone 3C1-G5
  • GAL monoclonal antibody (M01), clone 3C1-G5

GAL monoclonal antibody (M01), clone 3C1-G5

Ref: AB-H00051083-M01
GAL monoclonal antibody (M01), clone 3C1-G5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GAL.
Información adicional
Size 100 ug
Gene Name GAL
Gene Alias GALN|GLNN|GMAP|MGC40167
Gene Description galanin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51083
Clone Number 3C1-G5
Iso type IgG2a Kappa

Enviar uma mensagem


GAL monoclonal antibody (M01), clone 3C1-G5

GAL monoclonal antibody (M01), clone 3C1-G5