GAL polyclonal antibody (A01)
  • GAL polyclonal antibody (A01)

GAL polyclonal antibody (A01)

Ref: AB-H00051083-A01
GAL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GAL.
Información adicional
Size 50 uL
Gene Name GAL
Gene Alias GALN|GLNN|GMAP|MGC40167
Gene Description galanin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51083

Enviar uma mensagem


GAL polyclonal antibody (A01)

GAL polyclonal antibody (A01)