POLR1D purified MaxPab mouse polyclonal antibody (B01P)
  • POLR1D purified MaxPab mouse polyclonal antibody (B01P)

POLR1D purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051082-B01P
POLR1D purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POLR1D protein.
Información adicional
Size 50 ug
Gene Name POLR1D
Gene Alias FLJ20616|MGC9850|POLR1C|RPA16|RPA9|RPAC2|RPO1-3
Gene Description polymerase (RNA) I polypeptide D, 16kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR1D (NP_057056.1, 1 a.a. ~ 133 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51082

Enviar uma mensagem


POLR1D purified MaxPab mouse polyclonal antibody (B01P)

POLR1D purified MaxPab mouse polyclonal antibody (B01P)