NDUFA13 MaxPab rabbit polyclonal antibody (D01)
  • NDUFA13 MaxPab rabbit polyclonal antibody (D01)

NDUFA13 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051079-D01
NDUFA13 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFA13 protein.
Información adicional
Size 100 uL
Gene Name NDUFA13
Gene Alias B16.6|CDA016|CGI-39|GRIM-19|GRIM19
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51079

Enviar uma mensagem


NDUFA13 MaxPab rabbit polyclonal antibody (D01)

NDUFA13 MaxPab rabbit polyclonal antibody (D01)