NOSIP purified MaxPab mouse polyclonal antibody (B01P)
  • NOSIP purified MaxPab mouse polyclonal antibody (B01P)

NOSIP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051070-B01P
NOSIP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOSIP protein.
Información adicional
Size 50 ug
Gene Name NOSIP
Gene Alias CGI-25
Gene Description nitric oxide synthase interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOSIP (NP_057037.1, 1 a.a. ~ 301 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51070

Enviar uma mensagem


NOSIP purified MaxPab mouse polyclonal antibody (B01P)

NOSIP purified MaxPab mouse polyclonal antibody (B01P)