ZNF593 purified MaxPab mouse polyclonal antibody (B02P)
  • ZNF593 purified MaxPab mouse polyclonal antibody (B02P)

ZNF593 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051042-B02P
ZNF593 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF593 protein.
Información adicional
Size 50 ug
Gene Name ZNF593
Gene Alias ZT86
Gene Description zinc finger protein 593
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF593 (NP_056955.1, 1 a.a. ~ 116 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51042

Enviar uma mensagem


ZNF593 purified MaxPab mouse polyclonal antibody (B02P)

ZNF593 purified MaxPab mouse polyclonal antibody (B02P)