BOLA1 purified MaxPab mouse polyclonal antibody (B01P)
  • BOLA1 purified MaxPab mouse polyclonal antibody (B01P)

BOLA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051027-B01P
BOLA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BOLA1 protein.
Información adicional
Size 50 ug
Gene Name BOLA1
Gene Alias CGI-143|MGC75015|RP11-196G18.18
Gene Description bolA homolog 1 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BOLA1 (NP_057158.1, 1 a.a. ~ 137 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51027

Enviar uma mensagem


BOLA1 purified MaxPab mouse polyclonal antibody (B01P)

BOLA1 purified MaxPab mouse polyclonal antibody (B01P)