TTC11 polyclonal antibody (A01)
  • TTC11 polyclonal antibody (A01)

TTC11 polyclonal antibody (A01)

Ref: AB-H00051024-A01
TTC11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TTC11.
Información adicional
Size 50 uL
Gene Name FIS1
Gene Alias CGI-135|TTC11
Gene Description fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC11 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51024

Enviar uma mensagem


TTC11 polyclonal antibody (A01)

TTC11 polyclonal antibody (A01)