HEBP1 monoclonal antibody (M01), clone 1A4
  • HEBP1 monoclonal antibody (M01), clone 1A4

HEBP1 monoclonal antibody (M01), clone 1A4

Ref: AB-H00050865-M01
HEBP1 monoclonal antibody (M01), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HEBP1.
Información adicional
Size 100 ug
Gene Name HEBP1
Gene Alias HBP|HEBP
Gene Description heme binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEBP1 (NP_057071.2, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50865
Clone Number 1A4
Iso type IgG2b Kappa

Enviar uma mensagem


HEBP1 monoclonal antibody (M01), clone 1A4

HEBP1 monoclonal antibody (M01), clone 1A4