HEBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • HEBP1 purified MaxPab mouse polyclonal antibody (B01P)

HEBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00050865-B01P
HEBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HEBP1 protein.
Información adicional
Size 50 ug
Gene Name HEBP1
Gene Alias HBP|HEBP
Gene Description heme binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HEBP1 (AAH16277, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50865

Enviar uma mensagem


HEBP1 purified MaxPab mouse polyclonal antibody (B01P)

HEBP1 purified MaxPab mouse polyclonal antibody (B01P)