HNT purified MaxPab mouse polyclonal antibody (B01P)
  • HNT purified MaxPab mouse polyclonal antibody (B01P)

HNT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00050863-B01P
HNT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HNT protein.
Información adicional
Size 50 ug
Gene Name HNT
Gene Alias MGC60329|NTM
Gene Description neurotrimin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HNT (AAH50716.1, 1 a.a. ~ 316 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50863

Enviar uma mensagem


HNT purified MaxPab mouse polyclonal antibody (B01P)

HNT purified MaxPab mouse polyclonal antibody (B01P)