PARD6A polyclonal antibody (A01)
  • PARD6A polyclonal antibody (A01)

PARD6A polyclonal antibody (A01)

Ref: AB-H00050855-A01
PARD6A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PARD6A.
Información adicional
Size 50 uL
Gene Name PARD6A
Gene Alias PAR-6A|PAR6|PAR6C|PAR6alpha|TAX40|TIP-40
Gene Description par-6 partitioning defective 6 homolog alpha (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQGQASSGWGSRIRGDGSGFSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PARD6A (NP_058644, 247 a.a. ~ 346 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50855

Enviar uma mensagem


PARD6A polyclonal antibody (A01)

PARD6A polyclonal antibody (A01)