NSDHL monoclonal antibody (M01), clone 6E3
  • NSDHL monoclonal antibody (M01), clone 6E3

NSDHL monoclonal antibody (M01), clone 6E3

Ref: AB-H00050814-M01
NSDHL monoclonal antibody (M01), clone 6E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NSDHL.
Información adicional
Size 100 ug
Gene Name NSDHL
Gene Alias H105E3|SDR31E1|XAP104
Gene Description NAD(P) dependent steroid dehydrogenase-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NSDHL (NP_057006, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50814
Clone Number 6E3
Iso type IgG2a Kappa

Enviar uma mensagem


NSDHL monoclonal antibody (M01), clone 6E3

NSDHL monoclonal antibody (M01), clone 6E3