ARHGEF3 polyclonal antibody (A01)
  • ARHGEF3 polyclonal antibody (A01)

ARHGEF3 polyclonal antibody (A01)

Ref: AB-H00050650-A01
ARHGEF3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGEF3.
Información adicional
Size 50 uL
Gene Name ARHGEF3
Gene Alias DKFZp434F2429|FLJ98126|GEF3|MGC118905|STA3|XPLN
Gene Description Rho guanine nucleotide exchange factor (GEF) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF3 (NP_062455, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50650

Enviar uma mensagem


ARHGEF3 polyclonal antibody (A01)

ARHGEF3 polyclonal antibody (A01)