GEMIN4 monoclonal antibody (M01), clone 3E1
  • GEMIN4 monoclonal antibody (M01), clone 3E1

GEMIN4 monoclonal antibody (M01), clone 3E1

Ref: AB-H00050628-M01
GEMIN4 monoclonal antibody (M01), clone 3E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GEMIN4.
Información adicional
Size 100 ug
Gene Name GEMIN4
Gene Alias DKFZp434B131|DKFZp434D174|HC56|HCAP1|HHRF-1|p97
Gene Description gem (nuclear organelle) associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GEMIN4 (NP_056536, 959 a.a. ~ 1057 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50628
Clone Number 3E1
Iso type IgG2b Kappa

Enviar uma mensagem


GEMIN4 monoclonal antibody (M01), clone 3E1

GEMIN4 monoclonal antibody (M01), clone 3E1