ITSN2 polyclonal antibody (A01)
  • ITSN2 polyclonal antibody (A01)

ITSN2 polyclonal antibody (A01)

Ref: AB-H00050618-A01
ITSN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITSN2.
Información adicional
Size 50 uL
Gene Name ITSN2
Gene Alias KIAA1256|PRO2015|SH3D1B|SH3P18|SWA|SWAP
Gene Description intersectin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITSN2 (NP_006268, 471 a.a. ~ 571 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50618

Enviar uma mensagem


ITSN2 polyclonal antibody (A01)

ITSN2 polyclonal antibody (A01)