IL22 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL22 purified MaxPab rabbit polyclonal antibody (D01P)

IL22 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050616-D01P
IL22 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL22 protein.
Información adicional
Size 100 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL22 (NP_065386.1, 1 a.a. ~ 179 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50616

Enviar uma mensagem


IL22 purified MaxPab rabbit polyclonal antibody (D01P)

IL22 purified MaxPab rabbit polyclonal antibody (D01P)