IL20 monoclonal antibody (M01), clone 2H8
  • IL20 monoclonal antibody (M01), clone 2H8

IL20 monoclonal antibody (M01), clone 2H8

Ref: AB-H00050604-M01
IL20 monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL20.
Información adicional
Size 100 ug
Gene Name IL20
Gene Alias IL-20|IL10D|MGC96907|ZCYTO10
Gene Description interleukin 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL20 (NP_061194, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50604
Clone Number 2H8
Iso type IgG1 Kappa

Enviar uma mensagem


IL20 monoclonal antibody (M01), clone 2H8

IL20 monoclonal antibody (M01), clone 2H8