IL20 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL20 purified MaxPab rabbit polyclonal antibody (D01P)

IL20 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050604-D01P
IL20 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL20 protein.
Información adicional
Size 100 ug
Gene Name IL20
Gene Alias IL-20|IL10D|MGC96907|ZCYTO10
Gene Description interleukin 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL20 (NP_061194.2, 1 a.a. ~ 176 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50604

Enviar uma mensagem


IL20 purified MaxPab rabbit polyclonal antibody (D01P)

IL20 purified MaxPab rabbit polyclonal antibody (D01P)