SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)

SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050511-D01P
SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SYCP3 protein.
Información adicional
Size 100 ug
Gene Name SYCP3
Gene Alias COR1|MGC71888|SCP3
Gene Description synaptonemal complex protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SYCP3 (NP_710161.1, 1 a.a. ~ 236 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50511

Enviar uma mensagem


SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)

SYCP3 purified MaxPab rabbit polyclonal antibody (D01P)