COL5A3 polyclonal antibody (A01)
  • COL5A3 polyclonal antibody (A01)

COL5A3 polyclonal antibody (A01)

Ref: AB-H00050509-A01
COL5A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COL5A3.
Información adicional
Size 50 uL
Gene Name COL5A3
Gene Alias -
Gene Description collagen, type V, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL5A3 (NP_056534, 157 a.a. ~ 244 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50509

Enviar uma mensagem


COL5A3 polyclonal antibody (A01)

COL5A3 polyclonal antibody (A01)