RRM2B monoclonal antibody (M01), clone 6C1
  • RRM2B monoclonal antibody (M01), clone 6C1

RRM2B monoclonal antibody (M01), clone 6C1

Ref: AB-H00050484-M01
RRM2B monoclonal antibody (M01), clone 6C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RRM2B.
Información adicional
Size 50 ug
Gene Name RRM2B
Gene Alias DKFZp686M05248|MGC102856|MGC42116|p53R2
Gene Description ribonucleotide reductase M2 B (TP53 inducible)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50484
Clone Number 6C1
Iso type IgG2b Kappa

Enviar uma mensagem


RRM2B monoclonal antibody (M01), clone 6C1

RRM2B monoclonal antibody (M01), clone 6C1