KLK14 monoclonal antibody (M05), clone 2A7
  • KLK14 monoclonal antibody (M05), clone 2A7

KLK14 monoclonal antibody (M05), clone 2A7

Ref: AB-H00043847-M05
KLK14 monoclonal antibody (M05), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK14.
Información adicional
Size 100 ug
Gene Name KLK14
Gene Alias KLK-L6
Gene Description kallikrein-related peptidase 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK14 (NP_071329.1, 152 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 43847
Clone Number 2A7
Iso type IgG2b Kappa

Enviar uma mensagem


KLK14 monoclonal antibody (M05), clone 2A7

KLK14 monoclonal antibody (M05), clone 2A7