KLK14 purified MaxPab mouse polyclonal antibody (B01P)
  • KLK14 purified MaxPab mouse polyclonal antibody (B01P)

KLK14 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00043847-B01P
KLK14 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KLK14 protein.
Información adicional
Size 50 ug
Gene Name KLK14
Gene Alias KLK-L6
Gene Description kallikrein-related peptidase 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLK14 (ENSP00000156499, 1 a.a. ~ 251 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 43847

Enviar uma mensagem


KLK14 purified MaxPab mouse polyclonal antibody (B01P)

KLK14 purified MaxPab mouse polyclonal antibody (B01P)