TAX1BP3 monoclonal antibody (M01), clone 4A10
  • TAX1BP3 monoclonal antibody (M01), clone 4A10

TAX1BP3 monoclonal antibody (M01), clone 4A10

Ref: AB-H00030851-M01
TAX1BP3 monoclonal antibody (M01), clone 4A10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TAX1BP3.
Información adicional
Size 100 ug
Gene Name TAX1BP3
Gene Alias TIP-1
Gene Description Tax1 (human T-cell leukemia virus type I) binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30851
Clone Number 4A10
Iso type IgG1 kappa

Enviar uma mensagem


TAX1BP3 monoclonal antibody (M01), clone 4A10

TAX1BP3 monoclonal antibody (M01), clone 4A10