PIK3R4 monoclonal antibody (M03), clone 1G12
  • PIK3R4 monoclonal antibody (M03), clone 1G12

PIK3R4 monoclonal antibody (M03), clone 1G12

Ref: AB-H00030849-M03
PIK3R4 monoclonal antibody (M03), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Información adicional
Size 100 ug
Gene Name PIK3R4
Gene Alias MGC102700|VPS15|p150
Gene Description phosphoinositide-3-kinase, regulatory subunit 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30849
Clone Number 1G12
Iso type IgG2a Kappa

Enviar uma mensagem


PIK3R4 monoclonal antibody (M03), clone 1G12

PIK3R4 monoclonal antibody (M03), clone 1G12