KCNIP1 monoclonal antibody (M10), clone 3D9
  • KCNIP1 monoclonal antibody (M10), clone 3D9

KCNIP1 monoclonal antibody (M10), clone 3D9

Ref: AB-H00030820-M10
KCNIP1 monoclonal antibody (M10), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant KCNIP1.
Información adicional
Size 100 ug
Gene Name KCNIP1
Gene Alias KCHIP1|MGC95|VABP
Gene Description Kv channel interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNIP1 (AAH50375, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30820
Clone Number 3D9
Iso type IgG2a Kappa

Enviar uma mensagem


KCNIP1 monoclonal antibody (M10), clone 3D9

KCNIP1 monoclonal antibody (M10), clone 3D9