ST6GALNAC6 purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human ST6GALNAC6 protein.

AB-H00030815-B01P

New product

ST6GALNAC6 purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name ST6GALNAC6
Gene Alias RP11-203J24.3|SIAT7F|ST6GALNACVI
Gene Description ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ST6GALNAC6 (AAH07802, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30815

More info

Mouse polyclonal antibody raised against a full-length human ST6GALNAC6 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human ST6GALNAC6 protein.

Mouse polyclonal antibody raised against a full-length human ST6GALNAC6 protein.