SOX8 monoclonal antibody (M03), clone 5A7
  • SOX8 monoclonal antibody (M03), clone 5A7

SOX8 monoclonal antibody (M03), clone 5A7

Ref: AB-H00030812-M03
SOX8 monoclonal antibody (M03), clone 5A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX8.
Información adicional
Size 50 ug
Gene Name SOX8
Gene Alias MGC24837
Gene Description SRY (sex determining region Y)-box 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX8 (NP_055402, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30812
Clone Number 5A7
Iso type IgG2a Kappa

Enviar uma mensagem


SOX8 monoclonal antibody (M03), clone 5A7

SOX8 monoclonal antibody (M03), clone 5A7