SOX8 MaxPab mouse polyclonal antibody (B01P)
  • SOX8 MaxPab mouse polyclonal antibody (B01P)

SOX8 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00030812-B01P
SOX8 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SOX8 protein.
Información adicional
Size 50 ug
Gene Name SOX8
Gene Alias MGC24837
Gene Description SRY (sex determining region Y)-box 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLDMSEARSQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGVAVGGARGDPAEAADERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGALKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTHGPPTPPTTPKTELQQAGAKPELKLEGRRPVDSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOX8 (NP_055402.2, 1 a.a. ~ 446 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30812

Enviar uma mensagem


SOX8 MaxPab mouse polyclonal antibody (B01P)

SOX8 MaxPab mouse polyclonal antibody (B01P)