HUNK monoclonal antibody (M02), clone 1E4
  • HUNK monoclonal antibody (M02), clone 1E4

HUNK monoclonal antibody (M02), clone 1E4

Ref: AB-H00030811-M02
HUNK monoclonal antibody (M02), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HUNK.
Información adicional
Size 100 ug
Gene Name HUNK
Gene Alias -
Gene Description hormonally up-regulated Neu-associated kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HUNK (NP_055401, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30811
Clone Number 1E4
Iso type IgG2a Kappa

Enviar uma mensagem


HUNK monoclonal antibody (M02), clone 1E4

HUNK monoclonal antibody (M02), clone 1E4