RAX monoclonal antibody (M16), clone 1A10
  • RAX monoclonal antibody (M16), clone 1A10

RAX monoclonal antibody (M16), clone 1A10

Ref: AB-H00030062-M16
RAX monoclonal antibody (M16), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAX.
Información adicional
Size 100 ug
Gene Name RAX
Gene Alias MCOP3|RX
Gene Description retina and anterior neural fold homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAX (NP_038463, 253 a.a. ~ 346 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30062
Clone Number 1A10
Iso type IgG2a Kappa

Enviar uma mensagem


RAX monoclonal antibody (M16), clone 1A10

RAX monoclonal antibody (M16), clone 1A10