RAX monoclonal antibody (M10), clone 3E4
  • RAX monoclonal antibody (M10), clone 3E4

RAX monoclonal antibody (M10), clone 3E4

Ref: AB-H00030062-M10
RAX monoclonal antibody (M10), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAX.
Información adicional
Size 100 ug
Gene Name RAX
Gene Alias MCOP3|RX
Gene Description retina and anterior neural fold homeobox
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAX (NP_038463, 253 a.a. ~ 346 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30062
Clone Number 3E4
Iso type IgG2b Kappa

Enviar uma mensagem


RAX monoclonal antibody (M10), clone 3E4

RAX monoclonal antibody (M10), clone 3E4