TLX3 monoclonal antibody (M02), clone 5B11
  • TLX3 monoclonal antibody (M02), clone 5B11

TLX3 monoclonal antibody (M02), clone 5B11

Ref: AB-H00030012-M02
TLX3 monoclonal antibody (M02), clone 5B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLX3.
Información adicional
Size 100 ug
Gene Name TLX3
Gene Alias HOX11L2|MGC29804|RNX
Gene Description T-cell leukemia homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLX3 (NP_066305, 192 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 30012
Clone Number 5B11
Iso type IgG1 Kappa

Enviar uma mensagem


TLX3 monoclonal antibody (M02), clone 5B11

TLX3 monoclonal antibody (M02), clone 5B11