EFEMP2 MaxPab rabbit polyclonal antibody (D01)
  • EFEMP2 MaxPab rabbit polyclonal antibody (D01)

EFEMP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00030008-D01
EFEMP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EFEMP2 protein.
Información adicional
Size 100 uL
Gene Name EFEMP2
Gene Alias FBLN4|MBP1|UPH1
Gene Description EGF-containing fibulin-like extracellular matrix protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFSCSDIDECSYSSYLCQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EFEMP2 (AAH10456.1, 1 a.a. ~ 443 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 30008

Enviar uma mensagem


EFEMP2 MaxPab rabbit polyclonal antibody (D01)

EFEMP2 MaxPab rabbit polyclonal antibody (D01)