PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)
  • PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)

PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029993-B01P
PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PACSIN1 protein.
Información adicional
Size 50 ug
Gene Name PACSIN1
Gene Alias KIAA1379|SDPI
Gene Description protein kinase C and casein kinase substrate in neurons 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PACSIN1 (NP_065855.1, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29993

Enviar uma mensagem


PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)

PACSIN1 purified MaxPab mouse polyclonal antibody (B01P)