UBQLN1 polyclonal antibody (A01)
  • UBQLN1 polyclonal antibody (A01)

UBQLN1 polyclonal antibody (A01)

Ref: AB-H00029979-A01
UBQLN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UBQLN1.
Información adicional
Size 50 uL
Gene Name UBQLN1
Gene Alias DA41|DSK2|FLJ90054|PLIC-1|XDRP1
Gene Description ubiquilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAESGESGGPPGSQDSAAGAEGAGTPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNHDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBQLN1 (AAH39294, 1 a.a. ~ 589 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29979

Enviar uma mensagem


UBQLN1 polyclonal antibody (A01)

UBQLN1 polyclonal antibody (A01)