UBQLN2 polyclonal antibody (A01)
  • UBQLN2 polyclonal antibody (A01)

UBQLN2 polyclonal antibody (A01)

Ref: AB-H00029978-A01
UBQLN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBQLN2.
Información adicional
Size 50 uL
Gene Name UBQLN2
Gene Alias CHAP1|CHAP1/DSK2|Dsk2|HRIHFB2157|LIC-2|N4BP4|PLIC-2|PLIC2|RIHFB2157
Gene Description ubiquilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29978

Enviar uma mensagem


UBQLN2 polyclonal antibody (A01)

UBQLN2 polyclonal antibody (A01)