C16orf5 purified MaxPab mouse polyclonal antibody (B01P)
  • C16orf5 purified MaxPab mouse polyclonal antibody (B01P)

C16orf5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029965-B01P
C16orf5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C16orf5 protein.
Información adicional
Size 50 ug
Gene Name C16orf5
Gene Alias CDIP|I1
Gene Description chromosome 16 open reading frame 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C16orf5 (AAH02882, 1 a.a. ~ 208 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29965

Enviar uma mensagem


C16orf5 purified MaxPab mouse polyclonal antibody (B01P)

C16orf5 purified MaxPab mouse polyclonal antibody (B01P)