SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)

SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029957-B01P
SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC25A24 protein.
Información adicional
Size 50 ug
Gene Name SLC25A24
Gene Alias APC1|DKFZp586G0123|SCAMC-1
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC25A24 (AAH14519, 1 a.a. ~ 477 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29957

Enviar uma mensagem


SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)

SLC25A24 purified MaxPab mouse polyclonal antibody (B01P)