SERTAD1 monoclonal antibody (M07), clone 3H4
  • SERTAD1 monoclonal antibody (M07), clone 3H4

SERTAD1 monoclonal antibody (M07), clone 3H4

Ref: AB-H00029950-M07
SERTAD1 monoclonal antibody (M07), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SERTAD1.
Información adicional
Size 100 ug
Gene Name SERTAD1
Gene Alias SEI1|TRIP-Br1
Gene Description SERTA domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERTAD1 (AAH02670, 1 a.a. ~ 236 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29950
Clone Number 3H4
Iso type IgG2a Kappa

Enviar uma mensagem


SERTAD1 monoclonal antibody (M07), clone 3H4

SERTAD1 monoclonal antibody (M07), clone 3H4