IL19 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL19 purified MaxPab rabbit polyclonal antibody (D01P)

IL19 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029949-D01P
IL19 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL19 protein.
Información adicional
Size 100 ug
Gene Name IL19
Gene Alias IL-10C|MDA1|NG.1|ZMDA1
Gene Description interleukin 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGMKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL19 (NP_715639.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29949

Enviar uma mensagem


IL19 purified MaxPab rabbit polyclonal antibody (D01P)

IL19 purified MaxPab rabbit polyclonal antibody (D01P)