DSE monoclonal antibody (M03), clone 6D4
  • DSE monoclonal antibody (M03), clone 6D4

DSE monoclonal antibody (M03), clone 6D4

Ref: AB-H00029940-M03
DSE monoclonal antibody (M03), clone 6D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DSE.
Información adicional
Size 100 ug
Gene Name DSE
Gene Alias DSEPI|SART2
Gene Description dermatan sulfate epimerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LGEESPLETAASFFHNVDVPFEETVVDGVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRAAYLFIGPSIDVQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DSE (NP_037484, 574 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29940
Clone Number 6D4
Iso type IgG2a Kappa

Enviar uma mensagem


DSE monoclonal antibody (M03), clone 6D4

DSE monoclonal antibody (M03), clone 6D4