RPA4 purified MaxPab rabbit polyclonal antibody (D01P)
  • RPA4 purified MaxPab rabbit polyclonal antibody (D01P)

RPA4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029935-D01P
RPA4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPA4 protein.
Información adicional
Size 100 ug
Gene Name RPA4
Gene Alias HSU24186|MGC120333|MGC120334
Gene Description replication protein A4, 34kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPA4 (NP_037479.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29935

Enviar uma mensagem


RPA4 purified MaxPab rabbit polyclonal antibody (D01P)

RPA4 purified MaxPab rabbit polyclonal antibody (D01P)