SNX12 purified MaxPab rabbit polyclonal antibody (D01P)
  • SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029934-D01P
SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNX12 protein.
Información adicional
Size 100 ug
Gene Name SNX12
Gene Alias MGC118982|MGC118983
Gene Description sorting nexin 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX12 (N/A, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29934

Enviar uma mensagem


SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

SNX12 purified MaxPab rabbit polyclonal antibody (D01P)