PCDHB1 monoclonal antibody (M01A), clone 1H4
  • PCDHB1 monoclonal antibody (M01A), clone 1H4

PCDHB1 monoclonal antibody (M01A), clone 1H4

Ref: AB-H00029930-M01A
PCDHB1 monoclonal antibody (M01A), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHB1.
Información adicional
Size 200 uL
Gene Name PCDHB1
Gene Alias MGC138301|MGC138303|PCDH-BETA1
Gene Description protocadherin beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHB1 (NP_037472, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 29930
Clone Number 1H4
Iso type IgM Kappa

Enviar uma mensagem


PCDHB1 monoclonal antibody (M01A), clone 1H4

PCDHB1 monoclonal antibody (M01A), clone 1H4