TIMM22 purified MaxPab mouse polyclonal antibody (B01P)
  • TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029928-B01P
TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TIMM22 protein.
Información adicional
Size 50 ug
Gene Name TIMM22
Gene Alias TEX4|TIM22
Gene Description translocase of inner mitochondrial membrane 22 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TIMM22 (NP_037469, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29928

Enviar uma mensagem


TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

TIMM22 purified MaxPab mouse polyclonal antibody (B01P)