GMPPB polyclonal antibody (A01)
  • GMPPB polyclonal antibody (A01)

GMPPB polyclonal antibody (A01)

Ref: AB-H00029925-A01
GMPPB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GMPPB.
Información adicional
Size 50 uL
Gene Name GMPPB
Gene Alias KIAA1851
Gene Description GDP-mannose pyrophosphorylase B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMPPB (NP_037466, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29925

Enviar uma mensagem


GMPPB polyclonal antibody (A01)

GMPPB polyclonal antibody (A01)