NME7 polyclonal antibody (A01)
  • NME7 polyclonal antibody (A01)

NME7 polyclonal antibody (A01)

Ref: AB-H00029922-A01
NME7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NME7.
Información adicional
Size 50 uL
Gene Name NME7
Gene Alias FLJ37194|nm23-H7
Gene Description non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29922

Enviar uma mensagem


NME7 polyclonal antibody (A01)

NME7 polyclonal antibody (A01)